Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEM146 Rabbit Polyclonal Antibody (Biotin)

TMEM146 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

TMEM146

UniProt

Q86XM0

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TMEM146

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: NPHSLGFQATFYENGYTSDGNTKYKLDIFLKQQQHWGRTDSNFTSSLKKA

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

90kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human, Porcine

Tested Applications

WB

NCBI Accession Number

NP_689997

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Human p27 Polyclonal Antibody
PA83627HU-01 50 µg

Rabbit Anti-Human p27 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human p27 Polyclonal Antibody
PA83627HU-02 100 µg

Rabbit Anti-Human p27 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human p27 Polyclonal Antibody
PA83627HU-03 500 µg

Rabbit Anti-Human p27 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human p27 Polyclonal Antibody
PA83627HU-04 1 mg

Rabbit Anti-Human p27 Polyclonal Antibody

Sign In for Pricing
View Details
PARD6A (Partitioning Defective 6 Homolog alpha, PAR-6, PAR-6 alpha, PAR-6A, PAR6C, Tax Interaction Protein 40, TIP-40, PAR6A, TAX40) (MaxLight 750)
MBS6388435-01 0.1 mL

PARD6A (Partitioning Defective 6 Homolog alpha, PAR-6, PAR-6 alpha, PAR-6A, PAR6C, Tax Interaction Protein 40, TIP-40, PAR6A, TAX40) (MaxLight 750)

Sign In for Pricing
View Details
PARD6A (Partitioning Defective 6 Homolog alpha, PAR-6, PAR-6 alpha, PAR-6A, PAR6C, Tax Interaction Protein 40, TIP-40, PAR6A, TAX40) (MaxLight 750)
MBS6388435-02 5x 0.1 mL

PARD6A (Partitioning Defective 6 Homolog alpha, PAR-6, PAR-6 alpha, PAR-6A, PAR6C, Tax Interaction Protein 40, TIP-40, PAR6A, TAX40) (MaxLight 750)

Sign In for Pricing
View Details