Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRRC57 Rabbit Polyclonal Antibody (FITC)

LRRC57 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

DKFZp686H1865, FLJ36812

UniProt

Q8N9N7

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human LRRC57

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MGNSALRAHVETAQKTGVFQLKDRGLTEFPADLQKLTSNLRTIDLSNNKI

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_694992

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TC10, ID (RHOQ, ARHQ, RASL7A, TC10, Rho-related GTP-binding protein RhoQ, Ras-like protein TC10, Ras-like protein family member 7A) (MaxLight 405)
MBS6354276-01 0.1 mL

TC10, ID (RHOQ, ARHQ, RASL7A, TC10, Rho-related GTP-binding protein RhoQ, Ras-like protein TC10, Ras-like protein family member 7A) (MaxLight 405)

Sign In for Pricing
View Details
TC10, ID (RHOQ, ARHQ, RASL7A, TC10, Rho-related GTP-binding protein RhoQ, Ras-like protein TC10, Ras-like protein family member 7A) (MaxLight 405)
MBS6354276-02 5x 0.1 mL

TC10, ID (RHOQ, ARHQ, RASL7A, TC10, Rho-related GTP-binding protein RhoQ, Ras-like protein TC10, Ras-like protein family member 7A) (MaxLight 405)

Sign In for Pricing
View Details
PVRL4 (NECTIN4) (NM_030916) Human Mass Spec Standard
PH303431 10 µg

PVRL4 (NECTIN4) (NM_030916) Human Mass Spec Standard

Sign In for Pricing
View Details
AdmiRa-mmu-mir-497 Virus
mm0511 1.0 mL

AdmiRa-mmu-mir-497 Virus

Sign In for Pricing
View Details
ADPRH (ARH1, [Protein ADP-ribosylarginine] Hydrolase) (AP)
MBS6444897-01 0.1 mL

ADPRH (ARH1, [Protein ADP-ribosylarginine] Hydrolase) (AP)

Sign In for Pricing
View Details
ADPRH (ARH1, [Protein ADP-ribosylarginine] Hydrolase) (AP)
MBS6444897-02 5x 0.1 mL

ADPRH (ARH1, [Protein ADP-ribosylarginine] Hydrolase) (AP)

Sign In for Pricing
View Details