Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C10orf56 Rabbit Polyclonal Antibody (HRP)

C10orf56 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Z3CXXC8, C10orf56

UniProt

Q8N2G6

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human C10orf56

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LTEHFSDLTLTSEARKPSKRPPPNYLCHLCFNKGHYIKDCPQARPKGEGL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_699198

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Yersinia Enterocolitica yenR Protein (aa 1-244)
VAng-Wyb2009-500gEcoli 500 µg (E. coli)

Recombinant Yersinia Enterocolitica yenR Protein (aa 1-244)

Sign In for Pricing
View Details
Gm5113 (NM_001033540) Mouse Tagged Lenti ORF Clone
MR212547L3 10 µg

Gm5113 (NM_001033540) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Human PLTP Pre-designed siRNA Set A
SI012405A 1 Each

Human PLTP Pre-designed siRNA Set A

Sign In for Pricing
View Details
Zfp985 Mouse Gene Knockout Kit (CRISPR)
KN506656 1 Kit

Zfp985 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Hsa-miR-3140-3p mimic
HY-R00581-01 5 nmol

Hsa-miR-3140-3p mimic

Sign In for Pricing
View Details
Hsa-miR-3140-3p mimic
HY-R00581-02 20 nmol

Hsa-miR-3140-3p mimic

Sign In for Pricing
View Details