Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LYSMD2 Rabbit Polyclonal Antibody (HRP)

LYSMD2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DKFZp686I2243, MGC35274

UniProt

Q8IV50

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human LYSMD2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VEHRVRAGDTLQGIALKYGVTMEQIKRANKLFTNDCIFLKKTLNIPVISE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

23kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Guinea pig, Human, Mouse, Porcine, Rabbit, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_699205

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PerCP Anti-Human CD2 Antibody[TS1/8]
E-AB-F1148F-01 20 Tests

PerCP Anti-Human CD2 Antibody[TS1/8]

Sign In for Pricing
View Details
PerCP Anti-Human CD2 Antibody[TS1/8]
E-AB-F1148F-02 100 Tests

PerCP Anti-Human CD2 Antibody[TS1/8]

Sign In for Pricing
View Details
PerCP Anti-Human CD2 Antibody[TS1/8]
E-AB-F1148F-03 2x 100 Tests

PerCP Anti-Human CD2 Antibody[TS1/8]

Sign In for Pricing
View Details
HIST3H3 (HIST3H3, H3FT, Histone H3.1t, H3/g) (MaxLight 550)
MBS6420442-01 0.1 mL

HIST3H3 (HIST3H3, H3FT, Histone H3.1t, H3/g) (MaxLight 550)

Sign In for Pricing
View Details
HIST3H3 (HIST3H3, H3FT, Histone H3.1t, H3/g) (MaxLight 550)
MBS6420442-02 5x 0.1 mL

HIST3H3 (HIST3H3, H3FT, Histone H3.1t, H3/g) (MaxLight 550)

Sign In for Pricing
View Details
KRTAP4-1 3'UTR GFP Stable Cell Line
TU062114 1.0 mL

KRTAP4-1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details