Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Apbb2 Rabbit Polyclonal Antibody (Biotin)

Apbb2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

RGD1562438

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GQVATVSSSPETKKDHPKTGAKTDCALHRIQNLAPSDEESSWTTLSQDSA

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

77kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

XP_223399

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GTPBP3 Protein Vector (Human) (pPM-C-HA)
PV018967 500 ng

GTPBP3 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
5 MethylCytosine Rabbit Polyclonal Antibody (BF750)
orb2462130 100 µL

5 MethylCytosine Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details
RHBDF1 Antibody (Biotin)
orb517847-01 50 µg

RHBDF1 Antibody (Biotin)

Sign In for Pricing
View Details
RHBDF1 Antibody (Biotin)
orb517847-02 100 µg

RHBDF1 Antibody (Biotin)

Sign In for Pricing
View Details
Chikungunya Virus Spike E2 Glycoprotein (CHIKV-E2) Protein
abx060311 100 µg

Chikungunya Virus Spike E2 Glycoprotein (CHIKV-E2) Protein

Sign In for Pricing
View Details
Anti-TRPV3 Antibody Picoband® Fluoro488 Conjugated
PA1978-Fluoro488 100 µg/Vial

Anti-TRPV3 Antibody Picoband® Fluoro488 Conjugated

Sign In for Pricing
View Details