Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APBB2 Rabbit Polyclonal Antibody (FITC)

APBB2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

FE65L, FE65L1

UniProt

Q92870

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human APBB2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: QNLAPSDEESSWTTLSQDSASPSSPDETDIWSDHSFQTDPDLPPGWKRVS

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

81kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_775098

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SCXA, CT (SCXA, BHLHA41, SCX, Basic helix-loop-helix transcription factor scleraxis, Class A basic helix-loop-helix protein 41, Class A basic helix-loop-helix protein 48) (MaxLight 750) discontinued
041477-ML750 100 µL

SCXA, CT (SCXA, BHLHA41, SCX, Basic helix-loop-helix transcription factor scleraxis, Class A basic helix-loop-helix protein 41, Class A basic helix-loop-helix protein 48) (MaxLight 750) discontinued

Sign In for Pricing
View Details
CSNK2A2 Antibody
MBS9602328-01 0.05 mL

CSNK2A2 Antibody

Sign In for Pricing
View Details
CSNK2A2 Antibody
MBS9602328-02 0.1 mL

CSNK2A2 Antibody

Sign In for Pricing
View Details
CSNK2A2 Antibody
MBS9602328-03 0.2 mL

CSNK2A2 Antibody

Sign In for Pricing
View Details
CSNK2A2 Antibody
MBS9602328-04 5x 0.2 mL

CSNK2A2 Antibody

Sign In for Pricing
View Details
Mouse Glutamate Receptor Ionotropic, Nmda 3B (GRIN3B) Protein
abx659072-01 10 µg

Mouse Glutamate Receptor Ionotropic, Nmda 3B (GRIN3B) Protein

Sign In for Pricing
View Details