Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APBB2 Rabbit Polyclonal Antibody (HRP)

APBB2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FE65L, FE65L1

UniProt

Q92870

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human APBB2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QNLAPSDEESSWTTLSQDSASPSSPDETDIWSDHSFQTDPDLPPGWKRVS

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

81kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_775098

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CST8 Antibody
orb192152-01 50 μL

CST8 Antibody

Sign In for Pricing
View Details
CST8 Antibody
orb192152-02 100 µL

CST8 Antibody

Sign In for Pricing
View Details
EphA4 Antibody Blocking peptide
orb1446267 500 µg

EphA4 Antibody Blocking peptide

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Putative small ubiquitin-related modifier 7 (SUMO7)
MBS1391373-01 0.02 mg (E-Coli)

Recombinant Arabidopsis thaliana Putative small ubiquitin-related modifier 7 (SUMO7)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Putative small ubiquitin-related modifier 7 (SUMO7)
MBS1391373-02 0.1 mg (E-Coli)

Recombinant Arabidopsis thaliana Putative small ubiquitin-related modifier 7 (SUMO7)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Putative small ubiquitin-related modifier 7 (SUMO7)
MBS1391373-03 0.02 mg (Yeast)

Recombinant Arabidopsis thaliana Putative small ubiquitin-related modifier 7 (SUMO7)

Sign In for Pricing
View Details