Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARMC3 Rabbit Polyclonal Antibody (Biotin)

ARMC3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CT81, KU-CT-1

UniProt

Q5W041

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ARMC3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: YHFSAGFGSPIEDKSEPASGRNTVLSKSATKEKGWRKSKGKKEEEKVKEE

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

96kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_775104

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse Metallo-beta-lactamase domain-containing protein 2 (Mblac2)
MBS1303318-01 0.02 mg (E-Coli)

Recombinant Mouse Metallo-beta-lactamase domain-containing protein 2 (Mblac2)

Sign In for Pricing
View Details
Recombinant Mouse Metallo-beta-lactamase domain-containing protein 2 (Mblac2)
MBS1303318-02 0.02 mg (Yeast)

Recombinant Mouse Metallo-beta-lactamase domain-containing protein 2 (Mblac2)

Sign In for Pricing
View Details
Recombinant Mouse Metallo-beta-lactamase domain-containing protein 2 (Mblac2)
MBS1303318-03 0.1 mg (E-Coli)

Recombinant Mouse Metallo-beta-lactamase domain-containing protein 2 (Mblac2)

Sign In for Pricing
View Details
Recombinant Mouse Metallo-beta-lactamase domain-containing protein 2 (Mblac2)
MBS1303318-04 0.1 mg (Yeast)

Recombinant Mouse Metallo-beta-lactamase domain-containing protein 2 (Mblac2)

Sign In for Pricing
View Details
Recombinant Mouse Metallo-beta-lactamase domain-containing protein 2 (Mblac2)
MBS1303318-05 0.02 mg (Baculovirus)

Recombinant Mouse Metallo-beta-lactamase domain-containing protein 2 (Mblac2)

Sign In for Pricing
View Details
Recombinant Mouse Metallo-beta-lactamase domain-containing protein 2 (Mblac2)
MBS1303318-06 0.02 mg (Mammalian-Cell)

Recombinant Mouse Metallo-beta-lactamase domain-containing protein 2 (Mblac2)

Sign In for Pricing
View Details