Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RFESD Rabbit Polyclonal Antibody (HRP)

RFESD Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q8TAC1

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RFESD

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VVHDREVVIFYHKGEYHAMDIRCYHSGGPLHLGDIEDFDGRPCIVCPWHK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

18kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_775498

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human MINAR2 sgRNA gene knockout kit - Lentiviral human MINAR2 sgRNA gene knockout kit (plasmid)
GTR15392672 1 Vial

Lentiviral human MINAR2 sgRNA gene knockout kit - Lentiviral human MINAR2 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
4EBP1 Blocking Peptide
CBP4399-01 1 mg

4EBP1 Blocking Peptide

Sign In for Pricing
View Details
4EBP1 Blocking Peptide
CBP4399-02 5 mg

4EBP1 Blocking Peptide

Sign In for Pricing
View Details
PCDHA12 Polyclonal Antibody, APC-Cy5.5 Conjugated
bs-5825R-APC-Cy5.5 100 µL

PCDHA12 Polyclonal Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
SSR1 CRISPRa sgRNA lentivector (set of three targets)(Human)
45544121 3x 1.0µg DNA

SSR1 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Olfr720 Protein Vector (Mouse) (pPB-C-His)
PV211458 500 ng

Olfr720 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details