Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FLJ25791 Rabbit Polyclonal Antibody (FITC)

FLJ25791 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

MGC126763, MGC138153, FLJ25791

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human FLJ25791

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: EYTRKKYKKKMEQFMESCELITYLGAKMTRKYKEPQFRAIDFDHKLKTFL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_775830

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PGP9.5 Antibody
KC-096-01 50 μL

PGP9.5 Antibody

Sign In for Pricing
View Details
PGP9.5 Antibody
KC-096-02 100 µL

PGP9.5 Antibody

Sign In for Pricing
View Details
PGP9.5 Antibody
KC-096-03 1 mL

PGP9.5 Antibody

Sign In for Pricing
View Details
HEPC (HAMP) (NM_021175) Human Over-expression Lysate
LC402850 20 µg

HEPC (HAMP) (NM_021175) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Tcea1 activation kit by CRISPRa
GA204229 1 Kit

Mouse Tcea1 activation kit by CRISPRa

Sign In for Pricing
View Details
ITIH6 Human qPCR Primer Pair (NM_198510)
HP219365 200 Reactions

ITIH6 Human qPCR Primer Pair (NM_198510)

Sign In for Pricing
View Details