Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FLJ25791 Rabbit Polyclonal Antibody (HRP)

FLJ25791 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MGC126763, MGC138153, FLJ25791

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human FLJ25791

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EYTRKKYKKKMEQFMESCELITYLGAKMTRKYKEPQFRAIDFDHKLKTFL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_775830

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NF2 (h3) : 293T Lysate
sc-172383 100 µg - 200 µL

NF2 (h3) : 293T Lysate

Sign In for Pricing
View Details
Rabbit anti Saccharomyces cerevisiae a-Glucosidase, conjugated with Biotin
NE060/Bio 1 mL

Rabbit anti Saccharomyces cerevisiae a-Glucosidase, conjugated with Biotin

Sign In for Pricing
View Details
Annexin A1 Antibody (Center) [APR14932G]
APR14932G-01 50 µL

Annexin A1 Antibody (Center) [APR14932G]

Sign In for Pricing
View Details
Annexin A1 Antibody (Center) [APR14932G]
APR14932G-02 100 µL

Annexin A1 Antibody (Center) [APR14932G]

Sign In for Pricing
View Details
Annexin A1 Antibody (Center) [APR14932G]
APR14932G-03 200 µL

Annexin A1 Antibody (Center) [APR14932G]

Sign In for Pricing
View Details
Annexin A1 Antibody (Center) [APR14932G]
APR14932G-04 400 µL

Annexin A1 Antibody (Center) [APR14932G]

Sign In for Pricing
View Details