Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-37 Protein, Human (His)

IL-37 protein is an important immunoregulatory cytokine that suppresses innate inflammation and immune responses and reduces excessive inflammation.It signals intracellularly through nuclear translocation of SMAD3 and extracellularly through binding to its receptors, consisting of IL18R1 and IL18RAP.Animal-Free IL-37 Protein, Human (His) is the recombinant human-derived animal-FreeIL-37 protein, expressed by E.coli , with C-His labeled tag.This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-37 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-37-protein-human-his.html

Purity

95.0

Smiles

MKNLNPKKFSIHDQDHKVLVLDSGNLIAVPDKNYIRPEIFFALASSLSSASAEKGSPILLGVSKGEFCLYCDKDKGQSHPSLQLKKEKLMKLAAQKESARRPFIFYRAQVGSWNMLESAAHPGWFICTSCNCNEPVGVTDKFENRKHIEFSFQPVCKAEMSPSEVSD

Molecular Formula

27178 (Gene_ID) Q9NZH6-1 (K53-D218) (Accession)

Molecular Weight

Approximately 22 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

OBTF4 (Octamer Binding Transcription Factor 4) Human ELISA Kit
F5227 96 Tests

OBTF4 (Octamer Binding Transcription Factor 4) Human ELISA Kit

Sign In for Pricing
View Details
Guinea Pig alpha Endorphin ELISA Kit
MBS7257505-01 48 Well

Guinea Pig alpha Endorphin ELISA Kit

Sign In for Pricing
View Details
Guinea Pig alpha Endorphin ELISA Kit
MBS7257505-02 96 Well

Guinea Pig alpha Endorphin ELISA Kit

Sign In for Pricing
View Details
Guinea Pig alpha Endorphin ELISA Kit
MBS7257505-03 5x 96 Well

Guinea Pig alpha Endorphin ELISA Kit

Sign In for Pricing
View Details
Guinea Pig alpha Endorphin ELISA Kit
MBS7257505-04 10x 96 Well

Guinea Pig alpha Endorphin ELISA Kit

Sign In for Pricing
View Details
PSMA5 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
37944154 3x 1.0 µg DNA

PSMA5 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details