Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-37 Protein, Human (His)

IL-37 protein is an important immunoregulatory cytokine that suppresses innate inflammation and immune responses and reduces excessive inflammation.It signals intracellularly through nuclear translocation of SMAD3 and extracellularly through binding to its receptors, consisting of IL18R1 and IL18RAP.Animal-Free IL-37 Protein, Human (His) is the recombinant human-derived animal-FreeIL-37 protein, expressed by E.coli , with C-His labeled tag.This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-37 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-37-protein-human-his.html

Purity

95.0

Smiles

MKNLNPKKFSIHDQDHKVLVLDSGNLIAVPDKNYIRPEIFFALASSLSSASAEKGSPILLGVSKGEFCLYCDKDKGQSHPSLQLKKEKLMKLAAQKESARRPFIFYRAQVGSWNMLESAAHPGWFICTSCNCNEPVGVTDKFENRKHIEFSFQPVCKAEMSPSEVSD

Molecular Formula

27178 (Gene_ID) Q9NZH6-1 (K53-D218) (Accession)

Molecular Weight

Approximately 22 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC18 / Mucin 18 / CD146 (OJ79c), CF405S conjugate, 0.1mg/mL
BNC040676-500 1x 500 µL

MUC18 / Mucin 18 / CD146 (OJ79c), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (G3.1), CF488A conjugate, 0.1mg/mL
BNC880861-100 1x 100 µL

HSP27 (G3.1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD16 (C16/1045), CF488A conjugate, 0.1mg/mL
BNC881045-100 1x 100 µL

CD16 (C16/1045), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD53 (161-2), CF647 conjugate, 0.1mg/mL
BNC470324-100 1x 100 µL

CD53 (161-2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF488A conjugate, 0.1mg/mL
BNC880158-100 1x 100 µL

Cytokeratin 17 (E3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), CF640R conjugate, 0.1mg/mL
BNC400449-500 1x 500 µL

CD104 (UM-A9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details