Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rimklb Rabbit Polyclonal Antibody (Biotin)

Rimklb Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

N, Naags, AA097693, AI325948, AU015629, 4931417E21Rik, 4933426K21Rik

UniProt

Q80WS1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LFQKYIKESHGRDVRVIVVGGRVVGTMLRCSTDGRMQSNCSLGGVGMMCS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_081940

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Sbspon Pre-designed siRNA Set B
SI112511B 1 Each

Mouse Sbspon Pre-designed siRNA Set B

Sign In for Pricing
View Details
Screw Caps for internally threaded caps in 96-well format - Pink, 960 caps
1775-3121 960 Caps

Screw Caps for internally threaded caps in 96-well format - Pink, 960 caps

Sign In for Pricing
View Details
Sult2a6 3'UTR Luciferase Stable Cell Line
TU119936 1.0 mL

Sult2a6 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Recombinant Erwinia tasmaniensis Ferrochelatase (hemH)
MBS1132939-01 0.02 mg (E-Coli)

Recombinant Erwinia tasmaniensis Ferrochelatase (hemH)

Sign In for Pricing
View Details
Recombinant Erwinia tasmaniensis Ferrochelatase (hemH)
MBS1132939-02 0.02 mg (Yeast)

Recombinant Erwinia tasmaniensis Ferrochelatase (hemH)

Sign In for Pricing
View Details
Recombinant Erwinia tasmaniensis Ferrochelatase (hemH)
MBS1132939-03 0.1 mg (E-Coli)

Recombinant Erwinia tasmaniensis Ferrochelatase (hemH)

Sign In for Pricing
View Details