Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rimklb Rabbit Polyclonal Antibody (FITC)

Rimklb Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

N, Naags, AA097693, AI325948, AU015629, 4931417E21Rik, 4933426K21Rik

UniProt

Q80WS1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LFQKYIKESHGRDVRVIVVGGRVVGTMLRCSTDGRMQSNCSLGGVGMMCS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_081940

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TLE1 (Synovial Sarcoma Marker) (TLE1/2946R), CF594 conjugate, 0.1mg/mL
BNC942946-500 1x 500 µL

TLE1 (Synovial Sarcoma Marker) (TLE1/2946R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Rac-Taletrectinib Adipate
TRC-R949940-100MG 100 mg

Rac-Taletrectinib Adipate

Sign In for Pricing
View Details
METTL21D (VCPKMT) Human Gene Knockout Kit (CRISPR)
KN416594 1 Kit

METTL21D (VCPKMT) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Factor I (CFI) Mouse Monoclonal Antibody [Clone ID: OTI15E11]
CF806033 100 µg

Factor I (CFI) Mouse Monoclonal Antibody [Clone ID: OTI15E11]

Sign In for Pricing
View Details
Bcl-2 (Apoptosis & Follicular Lymphoma Marker) (BCL2/1878R), CF594 conjugate, 0.1mg/mL
BNC941878-500 1x 500 µL

Bcl-2 (Apoptosis & Follicular Lymphoma Marker) (BCL2/1878R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Arf1 Mouse Gene Knockout Kit (CRISPR)
KN501469 1 Kit

Arf1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details