Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DNAH6 Rabbit Polyclonal Antibody (HRP)

DNAH6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HL2, HL-2, DNHL1, Dnahc6

UniProt

Q9C0G6

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human DYH6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QIFFKENESLDLQALKLQEPDINFFSEQLEKYHKQHKDAVALRPTRNVGL

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MCP4/CCL13 Rabbit Polyclonal Antibody (Fluoro594)
orb3079127 100 µg

MCP4/CCL13 Rabbit Polyclonal Antibody (Fluoro594)

Sign In for Pricing
View Details
PIRC85 3'UTR Luciferase Stable Cell Line
TU018081 1.0 mL

PIRC85 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
C1orf177 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-15040R-BF594 100 µL

C1orf177 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
TCR αβ/alpha-beta TCR Rat Monoclonal Antibody (PerCP)
orb2971432-01 50 Tests

TCR αβ/alpha-beta TCR Rat Monoclonal Antibody (PerCP)

Sign In for Pricing
View Details
TCR αβ/alpha-beta TCR Rat Monoclonal Antibody (PerCP)
orb2971432-02 100 Tests

TCR αβ/alpha-beta TCR Rat Monoclonal Antibody (PerCP)

Sign In for Pricing
View Details
Recombinant Human CD120a/TNFRSF1A/TNFR1 Protein, N-GST
orb2832653-01 20 µg

Recombinant Human CD120a/TNFRSF1A/TNFR1 Protein, N-GST

Sign In for Pricing
View Details