Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DNAH6 Rabbit Polyclonal Antibody (HRP)

DNAH6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HL2, HL-2, DNHL1, Dnahc6

UniProt

Q9C0G6

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human DYH6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QIFFKENESLDLQALKLQEPDINFFSEQLEKYHKQHKDAVALRPTRNVGL

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAF7L (Transcription Initiation Factor TFIID Subunit 7-like, Cancer/Testis Antigen 40, CT40, RNA Polymerase II TBP-associated Factor Subunit Q, TATA Box-binding Protein-associated Factor 50kD, Transcription Initiation Factor TFIID 50kD Subunit, TAF2Q, FLJ
MBS6150020-01 0.1 mL

TAF7L (Transcription Initiation Factor TFIID Subunit 7-like, Cancer/Testis Antigen 40, CT40, RNA Polymerase II TBP-associated Factor Subunit Q, TATA Box-binding Protein-associated Factor 50kD, Transcription Initiation Factor TFIID 50kD Subunit, TAF2Q, FLJ

Sign In for Pricing
View Details
TAF7L (Transcription Initiation Factor TFIID Subunit 7-like, Cancer/Testis Antigen 40, CT40, RNA Polymerase II TBP-associated Factor Subunit Q, TATA Box-binding Protein-associated Factor 50kD, Transcription Initiation Factor TFIID 50kD Subunit, TAF2Q, FLJ
MBS6150020-02 5x 0.1 mL

TAF7L (Transcription Initiation Factor TFIID Subunit 7-like, Cancer/Testis Antigen 40, CT40, RNA Polymerase II TBP-associated Factor Subunit Q, TATA Box-binding Protein-associated Factor 50kD, Transcription Initiation Factor TFIID 50kD Subunit, TAF2Q, FLJ

Sign In for Pricing
View Details
FNTB Overexpression Lysate (Native) - (Dry Ice)
NBL1-10788 0.1 mg

FNTB Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
pOTB7-FAM110B Plasmid
PVT26395 2 µg

pOTB7-FAM110B Plasmid

Sign In for Pricing
View Details
Recombinant Mouse Guanine nucleotide-binding protein subunit alpha-15 (Gna15)
MBS960982-01 0.02 mg (E-Coli)

Recombinant Mouse Guanine nucleotide-binding protein subunit alpha-15 (Gna15)

Sign In for Pricing
View Details
Recombinant Mouse Guanine nucleotide-binding protein subunit alpha-15 (Gna15)
MBS960982-02 0.02 mg (Yeast)

Recombinant Mouse Guanine nucleotide-binding protein subunit alpha-15 (Gna15)

Sign In for Pricing
View Details