Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bloc1s2 Rabbit Polyclonal Antibody (Biotin)

Bloc1s2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

BL, Bloc, BLOS2, Bloc1s2a, 2410089B13Rik

UniProt

Q9CWG9

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: KEPAEADINELCRDMFSKMATYLTGELTATSEDYKLLENMNKLTSLKYLE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

15kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_082883

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RASSF8 Rabbit pAb, PE-Cy7 conjugated
orb2854030 100 µL

RASSF8 Rabbit pAb, PE-Cy7 conjugated

Sign In for Pricing
View Details
SMAP1L CRISPR Activation Plasmid (h)
sc-413021-ACT 20 µg

SMAP1L CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
MATK (NM_139354) Human Recombinant Protein
TP300454M 100 µg

MATK (NM_139354) Human Recombinant Protein

Sign In for Pricing
View Details
Mouse Monoclonal Arginase 1/ARG1/liver Arginase Antibody (ARG1/1125 + ARG1/1126) - IHC-Prediluted
NBP2-48255 7 mL

Mouse Monoclonal Arginase 1/ARG1/liver Arginase Antibody (ARG1/1125 + ARG1/1126) - IHC-Prediluted

Sign In for Pricing
View Details
YPEL2 Protein Vector (Human) (pPM-C-His)
PV059876 500 ng

YPEL2 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Rat Calcium Voltage-Gated Channel Auxiliary Subunit Gamma 4 (CACNG4) ELISA Kit
abx505537 96 Tests

Rat Calcium Voltage-Gated Channel Auxiliary Subunit Gamma 4 (CACNG4) ELISA Kit

Sign In for Pricing
View Details