Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bloc1s2 Rabbit Polyclonal Antibody (HRP)

Bloc1s2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

BL, Bloc, BLOS2, Bloc1s2a, 2410089B13Rik

UniProt

Q9CWG9

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KEPAEADINELCRDMFSKMATYLTGELTATSEDYKLLENMNKLTSLKYLE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

15kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_082883

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DLK1 (Delta Like 1 Homolog, FA1, PREF1, Pref-1, ZOG, pG2, Protein delta homolog 1, Fetal antigen 1)
362861 200 µL

DLK1 (Delta Like 1 Homolog, FA1, PREF1, Pref-1, ZOG, pG2, Protein delta homolog 1, Fetal antigen 1)

Sign In for Pricing
View Details
LIN54 Protein Vector (Mouse) (pPB-N-His)
PV196715 500 ng

LIN54 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
CSTA  polyclonal antibody
BS6994 50 ul

CSTA polyclonal antibody

Sign In for Pricing
View Details
FADD (Fas-Associated Death Domain Protein, MORT1) (AP)
MBS6416739-01 0.1 mL

FADD (Fas-Associated Death Domain Protein, MORT1) (AP)

Sign In for Pricing
View Details
FADD (Fas-Associated Death Domain Protein, MORT1) (AP)
MBS6416739-02 5x 0.1 mL

FADD (Fas-Associated Death Domain Protein, MORT1) (AP)

Sign In for Pricing
View Details
OR5W2, CT (OR5W2, OR5W2P, OR5W3P, Olfactory receptor 5W2, Olfactory receptor 5W3, Olfactory receptor OR11-155) (APC) discontinued
039463-APC 200 µL

OR5W2, CT (OR5W2, OR5W2P, OR5W3P, Olfactory receptor 5W2, Olfactory receptor 5W3, Olfactory receptor OR11-155) (APC) discontinued

Sign In for Pricing
View Details