Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TTC9C Rabbit Polyclonal Antibody (FITC)

TTC9C Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

MGC29649

UniProt

Q8N5M4

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TTC9C

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MEKRLQEAQLYKEEGNQRYREGKYRDAVSRYHRALLQLRGLDPSLPSPLP

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

20kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_776171

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF71, NT (ZNF71, EZFIT, Endothelial zinc finger protein induced by tumor necrosis factor alpha, Zinc finger protein 71) (MaxLight 405)
MBS6367553-01 0.1 mL

ZNF71, NT (ZNF71, EZFIT, Endothelial zinc finger protein induced by tumor necrosis factor alpha, Zinc finger protein 71) (MaxLight 405)

Sign In for Pricing
View Details
ZNF71, NT (ZNF71, EZFIT, Endothelial zinc finger protein induced by tumor necrosis factor alpha, Zinc finger protein 71) (MaxLight 405)
MBS6367553-02 5x 0.1 mL

ZNF71, NT (ZNF71, EZFIT, Endothelial zinc finger protein induced by tumor necrosis factor alpha, Zinc finger protein 71) (MaxLight 405)

Sign In for Pricing
View Details
ABflo® 594 Rabbit anti-Mouse CD126/IL-6Rα chain mAb
A25151-01 50 Tests

ABflo® 594 Rabbit anti-Mouse CD126/IL-6Rα chain mAb

Sign In for Pricing
View Details
ABflo® 594 Rabbit anti-Mouse CD126/IL-6Rα chain mAb
A25151-02 100 Tests

ABflo® 594 Rabbit anti-Mouse CD126/IL-6Rα chain mAb

Sign In for Pricing
View Details
ABflo® 594 Rabbit anti-Mouse CD126/IL-6Rα chain mAb
A25151-03 200 Tests

ABflo® 594 Rabbit anti-Mouse CD126/IL-6Rα chain mAb

Sign In for Pricing
View Details
ABflo® 594 Rabbit anti-Mouse CD126/IL-6Rα chain mAb
A25151-04 500 Tests

ABflo® 594 Rabbit anti-Mouse CD126/IL-6Rα chain mAb

Sign In for Pricing
View Details