Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COX18 Rabbit Polyclonal Antibody (FITC)

COX18 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

COX18HS

UniProt

Q8N8Q8

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human COX18

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LCSSFVGLSQNLLLRSPGFRQLCRIPSTKSDSETPYKDIFAAFNTKFISR

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_776188

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Ankrd11 Pre-designed siRNA Set B
SI200629B 1 Each

Rat Ankrd11 Pre-designed siRNA Set B

Sign In for Pricing
View Details
PSMB2 (Proteasome Subunit beta Type-2, Proteasome Component C7-I, Macropain Subunit C7-I, Multicatalytic Endopeptidase Complex Subunit C7-I, MGC104215, MGC126885) (MaxLight 650)
131951-ML650 100 µL

PSMB2 (Proteasome Subunit beta Type-2, Proteasome Component C7-I, Macropain Subunit C7-I, Multicatalytic Endopeptidase Complex Subunit C7-I, MGC104215, MGC126885) (MaxLight 650)

Sign In for Pricing
View Details
Recombinant Enterobacteria phage MS2 Assembly protein (A)
MBS1207927-01 0.02 mg (E-Coli)

Recombinant Enterobacteria phage MS2 Assembly protein (A)

Sign In for Pricing
View Details
Recombinant Enterobacteria phage MS2 Assembly protein (A)
MBS1207927-02 0.02 mg (Yeast)

Recombinant Enterobacteria phage MS2 Assembly protein (A)

Sign In for Pricing
View Details
Recombinant Enterobacteria phage MS2 Assembly protein (A)
MBS1207927-03 0.1 mg (E-Coli)

Recombinant Enterobacteria phage MS2 Assembly protein (A)

Sign In for Pricing
View Details
Recombinant Enterobacteria phage MS2 Assembly protein (A)
MBS1207927-04 0.1 mg (Yeast)

Recombinant Enterobacteria phage MS2 Assembly protein (A)

Sign In for Pricing
View Details