Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COX18 Rabbit Polyclonal Antibody (FITC)

COX18 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

COX18HS

UniProt

Q8N8Q8

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human COX18

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LCSSFVGLSQNLLLRSPGFRQLCRIPSTKSDSETPYKDIFAAFNTKFISR

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_776188

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TSC1, phosphorylated (T390) (TSC1, KIAA0243, TSC, Hamartin, Tuberous sclerosis 1 protein) (MaxLight 550) discontinued
043328-ML550 100 µL

TSC1, phosphorylated (T390) (TSC1, KIAA0243, TSC, Hamartin, Tuberous sclerosis 1 protein) (MaxLight 550) discontinued

Sign In for Pricing
View Details
SCN3B (HSA243396, SCNB3)
470152 50 µg

SCN3B (HSA243396, SCNB3)

Sign In for Pricing
View Details
DNA/RNA Shield (25 mL) (2X Concentrate) CE-IVD
R1200-25-E 25 mL

DNA/RNA Shield (25 mL) (2X Concentrate) CE-IVD

Sign In for Pricing
View Details
X-Pierce, Cover film, pierceable, preformed pierce, 100 pieces per CAR
676033 100 pieces per CAR

X-Pierce, Cover film, pierceable, preformed pierce, 100 pieces per CAR

Sign In for Pricing
View Details
PNKD, NT (PNKD, KIAA1184, MR1, TAHCCP2, Probable hydrolase PNKD, Myofibrillogenesis regulator 1, Paroxysmal nonkinesiogenic dyskinesia protein, Trans-activated by hepatitis C virus core protein 2)
040209 200 µL

PNKD, NT (PNKD, KIAA1184, MR1, TAHCCP2, Probable hydrolase PNKD, Myofibrillogenesis regulator 1, Paroxysmal nonkinesiogenic dyskinesia protein, Trans-activated by hepatitis C virus core protein 2)

Sign In for Pricing
View Details
Chicken Immunoglobulin 2alpha ELISA Kit
MBS7226774-01 48 Well

Chicken Immunoglobulin 2alpha ELISA Kit

Sign In for Pricing
View Details