Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COX18 Rabbit Polyclonal Antibody (HRP)

COX18 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

COX18HS

UniProt

Q8N8Q8

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human COX18

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LCSSFVGLSQNLLLRSPGFRQLCRIPSTKSDSETPYKDIFAAFNTKFISR

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_776188

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSP60 (Heat Shock Protein 60) (Mitochondrial Marker) (HSPD1/2206R), 0.2mg/mL
BNUB2206-500 1x 500 µL

HSP60 (Heat Shock Protein 60) (Mitochondrial Marker) (HSPD1/2206R), 0.2mg/mL

Sign In for Pricing
View Details
Recombinant Human Kallikrein 6/KLK6 Protein (His tag)
PDEH100956-01 20 µg

Recombinant Human Kallikrein 6/KLK6 Protein (His tag)

Sign In for Pricing
View Details
Recombinant Human Kallikrein 6/KLK6 Protein (His tag)
PDEH100956-02 100 µg

Recombinant Human Kallikrein 6/KLK6 Protein (His tag)

Sign In for Pricing
View Details
Recombinant Human Kallikrein 6/KLK6 Protein (His tag)
PDEH100956-03 500 µg

Recombinant Human Kallikrein 6/KLK6 Protein (His tag)

Sign In for Pricing
View Details
Recombinant Human Kallikrein 6/KLK6 Protein (His tag)
PDEH100956-04 1 mg

Recombinant Human Kallikrein 6/KLK6 Protein (His tag)

Sign In for Pricing
View Details
GAD1 / GAD67 (GABAergic Neuronal Marker) (GAD1/2391), CF405S conjugate, 0.1mg/mL
BNC042391-100 1x 100 µL

GAD1 / GAD67 (GABAergic Neuronal Marker) (GAD1/2391), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details