Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C6orf182 Rabbit Polyclonal Antibody (HRP)

C6orf182 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Cep57R, C6orf182, bA487F23.2

UniProt

Q8IYX8

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human C6orf182

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LNVEREKNMILEQQAQLQREKEQDQMKLYAKLEKLDVLEKECFRLTTTQK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_776191

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Hlcs shRNA (UAS) - Lentiviral mouse Hlcs shRNA (UAS) plasmid
GTR15178219 1 Vial

Lentiviral mouse Hlcs shRNA (UAS) - Lentiviral mouse Hlcs shRNA (UAS) plasmid

Sign In for Pricing
View Details
PRR3 Rabbit Polyclonal Antibody (APC)
orb3129410 100 µg

PRR3 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
Bovine Cancer susceptibility candidate protein 1 (CASC1) ELISA kit
GTR10405523 96 Well

Bovine Cancer susceptibility candidate protein 1 (CASC1) ELISA kit

Sign In for Pricing
View Details
Anti CapG Polyclonal Antibody
KR089 each

Anti CapG Polyclonal Antibody

Sign In for Pricing
View Details
DPP4 Activity Fluorometric Assay Kit
K779-100 100 Assays

DPP4 Activity Fluorometric Assay Kit

Sign In for Pricing
View Details
Mouse FBXO10 siRNA
abx916585-01 15 nmol

Mouse FBXO10 siRNA

Sign In for Pricing
View Details