Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sec14l3 Rabbit Polyclonal Antibody (Biotin)

Sec14l3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Spf2

UniProt

Q9Z1J8

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Rat

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: RDQVKTQYEHSVQISRGSSHQVEYEILFPGCVLRWQFSSDGADIGFGVFL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_072130

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STAG2 (Stromal Antigen 2, SA2, SA-2, Cohesin Subunit SA-2, SCC3 Homolog 2, SCC3B, bA517O1.1) (APC)
133915-APC 100 µL

STAG2 (Stromal Antigen 2, SA2, SA-2, Cohesin Subunit SA-2, SCC3 Homolog 2, SCC3B, bA517O1.1) (APC)

Sign In for Pricing
View Details
Human Survival Of Motor Neuron 2, Centromeric (SMN2) Antibody Pair Kit (with Standard)
MBS2102541-01 5x 96 Tests

Human Survival Of Motor Neuron 2, Centromeric (SMN2) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Human Survival Of Motor Neuron 2, Centromeric (SMN2) Antibody Pair Kit (with Standard)
MBS2102541-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Human Survival Of Motor Neuron 2, Centromeric (SMN2) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Human Survival Of Motor Neuron 2, Centromeric (SMN2) Antibody Pair Kit (with Standard)
MBS2102541-03 10x 96 Tests

Human Survival Of Motor Neuron 2, Centromeric (SMN2) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Human Survival Of Motor Neuron 2, Centromeric (SMN2) Antibody Pair Kit (with Standard)
MBS2102541-04 10x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1, 10x 96 Tests)

Human Survival Of Motor Neuron 2, Centromeric (SMN2) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Human Ribonuclease T2 (RNASET2) ELISA Kit
MBS2020833-01 24 Strip Well

Human Ribonuclease T2 (RNASET2) ELISA Kit

Sign In for Pricing
View Details