Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SEC14L4 Rabbit Polyclonal Antibody (FITC)

SEC14L4 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

TAP3

UniProt

Q9UDX3

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SEC14L4

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MSSRVGDLSPQQQEALARFRENLQDLLPILPNADDYFLLRWLRARNFDLQ

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_777637

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TSPAN6 AAV siRNA Pooled Vector
48596161 1.0 µg

TSPAN6 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Rabbit Polyclonal ETV5/ERM Antibody [DyLight 755]
NBP2-98876IR 0.1 mL

Rabbit Polyclonal ETV5/ERM Antibody [DyLight 755]

Sign In for Pricing
View Details
PUC57 Simple-PVT1
PPL00511 1 Each

PUC57 Simple-PVT1

Sign In for Pricing
View Details
Recombinant Beijerinckia indica subsp. indica Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha (accA)
MBS1151973-01 0.02 mg (E-Coli)

Recombinant Beijerinckia indica subsp. indica Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha (accA)

Sign In for Pricing
View Details
Recombinant Beijerinckia indica subsp. indica Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha (accA)
MBS1151973-02 0.02 mg (Yeast)

Recombinant Beijerinckia indica subsp. indica Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha (accA)

Sign In for Pricing
View Details
Recombinant Beijerinckia indica subsp. indica Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha (accA)
MBS1151973-03 0.1 mg (E-Coli)

Recombinant Beijerinckia indica subsp. indica Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha (accA)

Sign In for Pricing
View Details