Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SEC14L4 Rabbit Polyclonal Antibody (HRP)

SEC14L4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TAP3

UniProt

Q9UDX3

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SEC14L4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MSSRVGDLSPQQQEALARFRENLQDLLPILPNADDYFLLRWLRARNFDLQ

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_777637

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tris (4-aminophenyl) phosphate
JH920402 1 Each

Tris (4-aminophenyl) phosphate

Sign In for Pricing
View Details
ATM, CT (Serine-protein Kinase ATM, Ataxia Telangiectasia Mutated, A-T Mutated) (PE) discontinued
A4000-19C-PE 200 µL

ATM, CT (Serine-protein Kinase ATM, Ataxia Telangiectasia Mutated, A-T Mutated) (PE) discontinued

Sign In for Pricing
View Details
POU3F2 (BRN2, OCT7, OTF7, POU Domain, Class 3, Transcription Factor 2, Brain-specific Homeobox/POU Domain Protein 2, Nervous System-specific Octamer-binding Transcription Factor N-Oct-3, Octamer-binding Protein 7, Octamer-binding Transcription Factor 7) (MaxLight 405) discontinued
131625-ML405 100 µL

POU3F2 (BRN2, OCT7, OTF7, POU Domain, Class 3, Transcription Factor 2, Brain-specific Homeobox/POU Domain Protein 2, Nervous System-specific Octamer-binding Transcription Factor N-Oct-3, Octamer-binding Protein 7, Octamer-binding Transcription Factor 7) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Recombinant Human Neural cell adhesion molecule 1 (NCAM1), partial (Active)
orb2985940-01 20 µg

Recombinant Human Neural cell adhesion molecule 1 (NCAM1), partial (Active)

Sign In for Pricing
View Details
Recombinant Human Neural cell adhesion molecule 1 (NCAM1), partial (Active)
orb2985940-02 100 µg

Recombinant Human Neural cell adhesion molecule 1 (NCAM1), partial (Active)

Sign In for Pricing
View Details
Recombinant Human Neural cell adhesion molecule 1 (NCAM1), partial (Active)
orb2985940-03 1 mg

Recombinant Human Neural cell adhesion molecule 1 (NCAM1), partial (Active)

Sign In for Pricing
View Details