Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB37 Rabbit Polyclonal Antibody (FITC)

RAB37 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

FLJ30284, FLJ32507

UniProt

Q8IWA7

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RAB37

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ERVIRSEDGETLAREYGVPFLETSAKTGMNVELAFLAIAKELKYRAGHQA

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_783865

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tumor Necrosis Factor Receptor Superfamily Member 1B / CD120b (TNFRSF1B) Antibody (Biotin)
abx272936-01 200 µL

Tumor Necrosis Factor Receptor Superfamily Member 1B / CD120b (TNFRSF1B) Antibody (Biotin)

Sign In for Pricing
View Details
Tumor Necrosis Factor Receptor Superfamily Member 1B / CD120b (TNFRSF1B) Antibody (Biotin)
abx272936-02 1 mL

Tumor Necrosis Factor Receptor Superfamily Member 1B / CD120b (TNFRSF1B) Antibody (Biotin)

Sign In for Pricing
View Details
Anti-PIN4 Antibody (R2K97)
RHJ84202 100 μg

Anti-PIN4 Antibody (R2K97)

Sign In for Pricing
View Details
Olr1295 sgRNA CRISPR Lentivector (Rat) (Target 2)
K7435603 1.0 µg DNA

Olr1295 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Human Transcription factor YY2,YY2 ELISA KIT
ELI-44774h 96 Tests

Human Transcription factor YY2,YY2 ELISA KIT

Sign In for Pricing
View Details
HIF1 beta Recombinant Rabbit mAb
BS46837-01 50 µL

HIF1 beta Recombinant Rabbit mAb

Sign In for Pricing
View Details