Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ILDR1 Rabbit Polyclonal Antibody (FITC)

ILDR1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

DFNB42, ILDR1beta, ILDR1alpha, ILDR1alpha'

UniProt

Q86SU0

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ILDR1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RRGSHSPHWPEEKPPSYRSLDITPGKNSRKKGSVERRSEKDSSHSGRSVV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_787120

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(2S,6S) -2,6-Diaminoheptanedioic acid-13C7,15N2
HY-W334800S 1 mg

(2S,6S) -2,6-Diaminoheptanedioic acid-13C7,15N2

Sign In for Pricing
View Details
Flotillin 1/FLOT1 Rabbit Polyclonal Antibody
orb99195 100 µg

Flotillin 1/FLOT1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
25mm PES Syringe Filter 0.45um with Outer Ring and Printing
C0000661 100 x 100 Pcs/pack

25mm PES Syringe Filter 0.45um with Outer Ring and Printing

Sign In for Pricing
View Details
Human Interleukin-27 subunit beta, EBI3 ELISA Kit
MBS1606424-01 48 Well

Human Interleukin-27 subunit beta, EBI3 ELISA Kit

Sign In for Pricing
View Details
Human Interleukin-27 subunit beta, EBI3 ELISA Kit
MBS1606424-02 96 Well

Human Interleukin-27 subunit beta, EBI3 ELISA Kit

Sign In for Pricing
View Details
Human Interleukin-27 subunit beta, EBI3 ELISA Kit
MBS1606424-03 5x 96 Well

Human Interleukin-27 subunit beta, EBI3 ELISA Kit

Sign In for Pricing
View Details