Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ILDR1 Rabbit Polyclonal Antibody (HRP)

ILDR1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DFNB42, ILDR1beta, ILDR1alpha, ILDR1alpha'

UniProt

Q86SU0

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ILDR1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RRGSHSPHWPEEKPPSYRSLDITPGKNSRKKGSVERRSEKDSSHSGRSVV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_787120

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human UBE2C shRNA (UAS) - Lentiviral human UBE2C shRNA (UAS, iRFP) (25)
GTR15109430 1 Vial

Lentiviral human UBE2C shRNA (UAS) - Lentiviral human UBE2C shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
RPA2 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-4182R-BF680 100 µL

RPA2 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
Ugt1a6a (NM_145079) Mouse Tagged Lenti ORF Clone
MR208510L4 10 µg

Ugt1a6a (NM_145079) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant Mouse CD47 Protein (Met1-Lys140), RlgG Fc-tagged
CD47-892M 50 µg

Recombinant Mouse CD47 Protein (Met1-Lys140), RlgG Fc-tagged

Sign In for Pricing
View Details
Lentiviral mouse Maea shRNA (UAS) - Lentiviral mouse Maea shRNA (UAS, iRFP) plasmid
GTR15194608 1 Vial

Lentiviral mouse Maea shRNA (UAS) - Lentiviral mouse Maea shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
EIF4A2 (NM_001967) Human Tagged Lenti ORF Clone
RC205623L3 10 µg

EIF4A2 (NM_001967) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details