Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARL5A Rabbit Polyclonal Antibody (Biotin)

ARL5A Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ARL5, ARFLP5

UniProt

Q9Y689

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ARL5A

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: YKMLAHEDLRKAGLLIFANKQDVKECMTVAEISQFLKLTSIKDHQWHIQA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

20kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_036229

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Cysteine Rich With EGF Like Domains Protein 1 (CRELD1) ELISA Kit
MBS458561-01 48 Tests

Human Cysteine Rich With EGF Like Domains Protein 1 (CRELD1) ELISA Kit

Sign In for Pricing
View Details
Human Cysteine Rich With EGF Like Domains Protein 1 (CRELD1) ELISA Kit
MBS458561-02 96 Tests

Human Cysteine Rich With EGF Like Domains Protein 1 (CRELD1) ELISA Kit

Sign In for Pricing
View Details
Human Cysteine Rich With EGF Like Domains Protein 1 (CRELD1) ELISA Kit
MBS458561-03 5x 96 Tests

Human Cysteine Rich With EGF Like Domains Protein 1 (CRELD1) ELISA Kit

Sign In for Pricing
View Details
Human Cysteine Rich With EGF Like Domains Protein 1 (CRELD1) ELISA Kit
MBS458561-04 10x 96 Tests

Human Cysteine Rich With EGF Like Domains Protein 1 (CRELD1) ELISA Kit

Sign In for Pricing
View Details
Human Lectin Like Oxidized Low Density Lipoprotein Receptor 1 (LOX1) ELISA Kit
orb1665029-01 48 Tests

Human Lectin Like Oxidized Low Density Lipoprotein Receptor 1 (LOX1) ELISA Kit

Sign In for Pricing
View Details
Human Lectin Like Oxidized Low Density Lipoprotein Receptor 1 (LOX1) ELISA Kit
orb1665029-02 96 Tests

Human Lectin Like Oxidized Low Density Lipoprotein Receptor 1 (LOX1) ELISA Kit

Sign In for Pricing
View Details