Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANGPTL5 Rabbit Polyclonal Antibody (HRP)

ANGPTL5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q86XS5

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ANGPTL5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ASLDYLSNQVNELMNRVLLLTTEVFRKQLDPFPHRPVQSHGLDCTDIKDT

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Porcine

Tested Applications

WB

NCBI Accession Number

NP_835228

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC20A1 Human Pre-designed siRNA Set A
HY-RS13059 1 Set

SLC20A1 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
Human BOP1 Pre-designed siRNA Set A
SI001636A 1 Each

Human BOP1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Mouse DPP9 (Dipeptidyl Peptidase 9) ELISA Kit
EM23621 96 Tests

Mouse DPP9 (Dipeptidyl Peptidase 9) ELISA Kit

Sign In for Pricing
View Details
LOX1 (Lectin Like Oxidized Low Density Lipoprotein Receptor 1, OLR1, CLEC8A, SCARE1, Oxidized low-density lipoprotein receptor 1, C-type lectin domain family 8 member A, Lectin-like oxidized LDL receptor 1, Lectin-type oxidized LDL receptor 1)
363990 200 µL

LOX1 (Lectin Like Oxidized Low Density Lipoprotein Receptor 1, OLR1, CLEC8A, SCARE1, Oxidized low-density lipoprotein receptor 1, C-type lectin domain family 8 member A, Lectin-like oxidized LDL receptor 1, Lectin-type oxidized LDL receptor 1)

Sign In for Pricing
View Details
Anti-SPIDR Antibody Picoband®, Dylight594 Conjugate
A04260-1-Dylight594 100 µg

Anti-SPIDR Antibody Picoband®, Dylight594 Conjugate

Sign In for Pricing
View Details
MYL12B antibody
70R-18707 50 μL

MYL12B antibody

Sign In for Pricing
View Details