Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GNRH2 Rabbit Polyclonal Antibody (FITC)

GNRH2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

GnRH-II, LH-RHII

UniProt

O43555

Immunogen

The immunogen is a synthetic peptide directed towards the following sequence SDALAPLDDSMPWEGRTTAQWSLHRKRHLARTLLTAAREPRPAPPSSNKV

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SDALAPLDDSMPWEGRTTAQWSLHRKRHLARTLLTAAREPRPAPPSSNKV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

13 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

IHC

NCBI Accession Number

NP_847902

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kappa Light Chain (HCAK1, Ig kappa Chain C Region, IGKC, Immunoglobulin kappa Constant Region, Immunoglobulin kappa Light Chain, Kappa 1 Immunoglobulin Light Chain, Km, MGC111575, MGC62011, MGC72072, MGC88770, MGC88771, MGC88809) (MaxLight 650)
K0090-03-ML650 100 µL

Kappa Light Chain (HCAK1, Ig kappa Chain C Region, IGKC, Immunoglobulin kappa Constant Region, Immunoglobulin kappa Light Chain, Kappa 1 Immunoglobulin Light Chain, Km, MGC111575, MGC62011, MGC72072, MGC88770, MGC88771, MGC88809) (MaxLight 650)

Sign In for Pricing
View Details
Methyltransferase-Like protein 5 (METTL5) Mouse ELISA Kit
E9793 96 Tests

Methyltransferase-Like protein 5 (METTL5) Mouse ELISA Kit

Sign In for Pricing
View Details
PTGS2, ID (P378) (PTGS2, COX2, Prostaglandin G/H synthase 2, Cyclooxygenase-2, PHS II, Prostaglandin H2 synthase 2, Prostaglandin-endoperoxide synthase 2) (MaxLight 405)
MBS6338760-01 0.1 mL

PTGS2, ID (P378) (PTGS2, COX2, Prostaglandin G/H synthase 2, Cyclooxygenase-2, PHS II, Prostaglandin H2 synthase 2, Prostaglandin-endoperoxide synthase 2) (MaxLight 405)

Sign In for Pricing
View Details
PTGS2, ID (P378) (PTGS2, COX2, Prostaglandin G/H synthase 2, Cyclooxygenase-2, PHS II, Prostaglandin H2 synthase 2, Prostaglandin-endoperoxide synthase 2) (MaxLight 405)
MBS6338760-02 5x 0.1 mL

PTGS2, ID (P378) (PTGS2, COX2, Prostaglandin G/H synthase 2, Cyclooxygenase-2, PHS II, Prostaglandin H2 synthase 2, Prostaglandin-endoperoxide synthase 2) (MaxLight 405)

Sign In for Pricing
View Details
Lentiviral mouse Zfp560 shRNA (UAS) - Lentiviral mouse Zfp560 shRNA (UAS, iRFP) (100)
GTR15241815 1 Vial

Lentiviral mouse Zfp560 shRNA (UAS) - Lentiviral mouse Zfp560 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
2019-nCoV Spike Protein RBD (E484K)
P2333-1mg 1 mg

2019-nCoV Spike Protein RBD (E484K)

Sign In for Pricing
View Details