Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tspan33 Rabbit Polyclonal Antibody (HRP)

Tspan33 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RGD1560915

UniProt

D3Z967

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Rat

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NTMCGQGMQALDYLEASKVIYTNGCIDKLVNWIHSNLFLLGGVALGLAIP

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

31kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001102697

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C13orf3, ID (Chromosome 13 Open Reading Frame 3, Spindle And Kinetochore-associated Protein 3, SKA3, C13orf3, RAMA1) (Azide free) (HRP)
MBS6469025-01 0.2 mL

C13orf3, ID (Chromosome 13 Open Reading Frame 3, Spindle And Kinetochore-associated Protein 3, SKA3, C13orf3, RAMA1) (Azide free) (HRP)

Sign In for Pricing
View Details
C13orf3, ID (Chromosome 13 Open Reading Frame 3, Spindle And Kinetochore-associated Protein 3, SKA3, C13orf3, RAMA1) (Azide free) (HRP)
MBS6469025-02 5x 0.2 mL

C13orf3, ID (Chromosome 13 Open Reading Frame 3, Spindle And Kinetochore-associated Protein 3, SKA3, C13orf3, RAMA1) (Azide free) (HRP)

Sign In for Pricing
View Details
KDM5A Antibody
orb1560736-01 50 µL

KDM5A Antibody

Sign In for Pricing
View Details
KDM5A Antibody
orb1560736-02 100 µL

KDM5A Antibody

Sign In for Pricing
View Details
KDM5A Antibody
orb1560736-03 200 µL

KDM5A Antibody

Sign In for Pricing
View Details
Piperazine-bis (ethyl octadeca-9,12-dienoate)
TCL-00085-01 1 mg

Piperazine-bis (ethyl octadeca-9,12-dienoate)

Sign In for Pricing
View Details