Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZDHHC21 Rabbit Polyclonal Antibody (FITC)

ZDHHC21 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

DNZ1, DHHC21, DHHC-21, HSPC097

UniProt

Q5RB84

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZDHHC21

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ELLTCYALMFSFCHYYYFLPLKKRNLDLFVFRHELAIMRLAAFMGITMLV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

31kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_848661

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CAMK2D, CT (Calcium/Calmodulin-dependent Protein Kinase Type II Subunit delta, CaM-kinase II Subunit delta, CaMK-II Subunit delta, CAMKD) (FITC) discontinued
C1035-25W1-FITC 200 µL

CAMK2D, CT (Calcium/Calmodulin-dependent Protein Kinase Type II Subunit delta, CaM-kinase II Subunit delta, CaMK-II Subunit delta, CAMKD) (FITC) discontinued

Sign In for Pricing
View Details
TIMELESS antibody - N-terminal region
MBS3201914-01 0.1 mL

TIMELESS antibody - N-terminal region

Sign In for Pricing
View Details
TIMELESS antibody - N-terminal region
MBS3201914-02 5x 0.1 mL

TIMELESS antibody - N-terminal region

Sign In for Pricing
View Details
Rabbit Polyclonal DEPDC1B Antibody [mFluor Violet 610 SE]
NBP2-81913MFV610 0.1 mL

Rabbit Polyclonal DEPDC1B Antibody [mFluor Violet 610 SE]

Sign In for Pricing
View Details
SLC27A5 Antibody - middle region : HRP (ARP41592_P050-HRP)
ARP41592_P050-HRP 100 µL

SLC27A5 Antibody - middle region : HRP (ARP41592_P050-HRP)

Sign In for Pricing
View Details
Anti-NUP88 Antibody
A05382-1 100 µL

Anti-NUP88 Antibody

Sign In for Pricing
View Details