Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZDHHC21 Rabbit Polyclonal Antibody (FITC)

ZDHHC21 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

DNZ1, DHHC21, DHHC-21, HSPC097

UniProt

Q5RB84

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZDHHC21

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ELLTCYALMFSFCHYYYFLPLKKRNLDLFVFRHELAIMRLAAFMGITMLV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

31kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_848661

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF837 Protein Vector (Human) (pPM-C-HA)
PV145764 500 ng

ZNF837 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Porcine Component of gems 4 (GEMIN4) ELISA Kit
MBS7217925-01 48 Well

Porcine Component of gems 4 (GEMIN4) ELISA Kit

Sign In for Pricing
View Details
Porcine Component of gems 4 (GEMIN4) ELISA Kit
MBS7217925-02 96 Well

Porcine Component of gems 4 (GEMIN4) ELISA Kit

Sign In for Pricing
View Details
Porcine Component of gems 4 (GEMIN4) ELISA Kit
MBS7217925-03 5x 96 Well

Porcine Component of gems 4 (GEMIN4) ELISA Kit

Sign In for Pricing
View Details
Porcine Component of gems 4 (GEMIN4) ELISA Kit
MBS7217925-04 10x 96 Well

Porcine Component of gems 4 (GEMIN4) ELISA Kit

Sign In for Pricing
View Details
OR9G4, CT (OR9G4, Olfactory receptor 9G4, Olfactory receptor OR11-216)
039495 200 µL

OR9G4, CT (OR9G4, Olfactory receptor 9G4, Olfactory receptor OR11-216)

Sign In for Pricing
View Details