Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRRTM1 Rabbit Polyclonal Antibody (HRP)

LRRTM1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FLJ32082

UniProt

Q86UE6

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human LRRTM1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RIFQDCRSLKFLDIGYNQLKSLARNSFAGLFKLTELHLEHNDLVKVNFAH

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

59kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_849161

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Chemokine Like Factor Superfamily 5 ELISA Kit
MBS764728-01 48 Well

Rat Chemokine Like Factor Superfamily 5 ELISA Kit

Sign In for Pricing
View Details
Rat Chemokine Like Factor Superfamily 5 ELISA Kit
MBS764728-02 96 Well

Rat Chemokine Like Factor Superfamily 5 ELISA Kit

Sign In for Pricing
View Details
Rat Chemokine Like Factor Superfamily 5 ELISA Kit
MBS764728-03 5x 96 Well

Rat Chemokine Like Factor Superfamily 5 ELISA Kit

Sign In for Pricing
View Details
Rat Chemokine Like Factor Superfamily 5 ELISA Kit
MBS764728-04 10x 96 Well

Rat Chemokine Like Factor Superfamily 5 ELISA Kit

Sign In for Pricing
View Details
Boc-N-Me-DL-Val-OH
A-3500.0005 5.0g

Boc-N-Me-DL-Val-OH

Sign In for Pricing
View Details
JNK1, CT (c-Jun N-terminal Kinase 1, JNK1A2, JNK, JNK21B1/2, JNK-46, Mitogen-activated Protein Kinase 8, MAP Kinase 8, MAPK 8, MAPK8, PRKM8, Stress-activated Protein Kinase 1c, SAPK1c, SAPK1, Stress-activated Protein Kinase JNK1) (MaxLight 490) discontinued
J2499-95M-ML490 100 µL

JNK1, CT (c-Jun N-terminal Kinase 1, JNK1A2, JNK, JNK21B1/2, JNK-46, Mitogen-activated Protein Kinase 8, MAP Kinase 8, MAPK 8, MAPK8, PRKM8, Stress-activated Protein Kinase 1c, SAPK1c, SAPK1, Stress-activated Protein Kinase JNK1) (MaxLight 490) discontinued

Sign In for Pricing
View Details