Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LEMD2 Rabbit Polyclonal Antibody (FITC)

LEMD2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

LEM2, NET25, CTRCT42, dJ482C21.1

UniProt

Q8NC56

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human LEMD2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: QDMERYPYVGILHVRDSLIPPQSRRRMKRVWDRAVEFLASNESRIQTESH

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_851853

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea pig Down syndrome critical region protein 9 (DSCR9) ELISA Kit
MBS2606138-01 48 Well

Guinea pig Down syndrome critical region protein 9 (DSCR9) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Down syndrome critical region protein 9 (DSCR9) ELISA Kit
MBS2606138-02 96 Well

Guinea pig Down syndrome critical region protein 9 (DSCR9) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Down syndrome critical region protein 9 (DSCR9) ELISA Kit
MBS2606138-03 5x 96 Well

Guinea pig Down syndrome critical region protein 9 (DSCR9) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Down syndrome critical region protein 9 (DSCR9) ELISA Kit
MBS2606138-04 10x 96 Well

Guinea pig Down syndrome critical region protein 9 (DSCR9) ELISA Kit

Sign In for Pricing
View Details
HLA-C Antibody (YA3019, Rabbit)
HY-P83274-01 10 µL

HLA-C Antibody (YA3019, Rabbit)

Sign In for Pricing
View Details
HLA-C Antibody (YA3019, Rabbit)
HY-P83274-02 50 μL

HLA-C Antibody (YA3019, Rabbit)

Sign In for Pricing
View Details