Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Eras Rabbit Polyclonal Antibody (HRP)

Eras Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

H, HR, Ha-, ecat, HRAS2, HRasp, ecat5, Ha-Ras2

UniProt

Q7TN89

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LPTKSSILDLSSGTPCTRSPEESHEAWAQCKDAGRQLPEYKAVVVGASGV

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_853526

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gpr125 ORF Vector (Mouse) (pORF)
ORF046479 1.0 µg DNA

Gpr125 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
PathScan® RP Phospho-HS1 (Tyr378/397) Sandwich ELISA Kit II
CST 74506V3 20 Kit

PathScan® RP Phospho-HS1 (Tyr378/397) Sandwich ELISA Kit II

Sign In for Pricing
View Details
(5-Chloro-2-methoxyphenyl) methanol
436081-01 2.5 g

(5-Chloro-2-methoxyphenyl) methanol

Sign In for Pricing
View Details
(5-Chloro-2-methoxyphenyl) methanol
436081-02 25 g

(5-Chloro-2-methoxyphenyl) methanol

Sign In for Pricing
View Details
Mouse Monoclonal Mouse IgG2a Isotype Control (M2AK) [DyLight 594]
NBP1-96981DL594 0.5 mL

Mouse Monoclonal Mouse IgG2a Isotype Control (M2AK) [DyLight 594]

Sign In for Pricing
View Details
GTF2H2 (General Transcription Factor IIH Subunit 2, General Transcription Factor IIH Polypeptide 2, TFIIH Basal Transcription Factor Complex p44 Subunit, Basic Transcription Factor 2 44kD Subunit, BTF2-p44, BTF2P44) (FITC)
127640-FITC 100 µL

GTF2H2 (General Transcription Factor IIH Subunit 2, General Transcription Factor IIH Polypeptide 2, TFIIH Basal Transcription Factor Complex p44 Subunit, Basic Transcription Factor 2 44kD Subunit, BTF2-p44, BTF2P44) (FITC)

Sign In for Pricing
View Details