Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMCO4 Rabbit Polyclonal Antibody (FITC)

TMCO4 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

DKFZp686C23231, RP5-1056L3.6

UniProt

Q5TGY1

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human TMCO4

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: WPASLLSVANVIDNPWGVCLHRSAEVGKHLAHILLSRQQGRRPVTLIGFS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

68kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_859070

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Septin 2 Conjugated Antibody
C49788 100 µL

Septin 2 Conjugated Antibody

Sign In for Pricing
View Details
Rabbit anti-Oryza sativa subsp. indica (Rice) ERG1 Polyclonal Antibody
MBS7167592 Inquire

Rabbit anti-Oryza sativa subsp. indica (Rice) ERG1 Polyclonal Antibody

Sign In for Pricing
View Details
CD80 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-2211R-BF647-01 20 µL

CD80 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
CD80 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-2211R-BF647-02 100 µL

CD80 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
Recombinant Bacillus weihenstephanensis Purine nucleoside phosphorylase DeoD-type (deoD)
MBS1058311-01 0.02 mg (E-Coli)

Recombinant Bacillus weihenstephanensis Purine nucleoside phosphorylase DeoD-type (deoD)

Sign In for Pricing
View Details
Recombinant Bacillus weihenstephanensis Purine nucleoside phosphorylase DeoD-type (deoD)
MBS1058311-02 0.1 mg (E-Coli)

Recombinant Bacillus weihenstephanensis Purine nucleoside phosphorylase DeoD-type (deoD)

Sign In for Pricing
View Details