Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EFHA2 Rabbit Polyclonal Antibody (HRP)

EFHA2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

EFHA2

UniProt

Q86XE3

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human EFHA2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AAAGGGLVGLVCYQLYGDPRAGSPATGRPSKSAATEPEDPPRGRGMLPIP

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

61kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human, Mouse, Porcine, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_859074

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MLH1, CT (DNA mismatch repair protein Mlh1, MutL protein homolog 1, COCA2, MLH1) (MaxLight 405)
MBS6321080-01 0.1 mL

MLH1, CT (DNA mismatch repair protein Mlh1, MutL protein homolog 1, COCA2, MLH1) (MaxLight 405)

Sign In for Pricing
View Details
MLH1, CT (DNA mismatch repair protein Mlh1, MutL protein homolog 1, COCA2, MLH1) (MaxLight 405)
MBS6321080-02 5x 0.1 mL

MLH1, CT (DNA mismatch repair protein Mlh1, MutL protein homolog 1, COCA2, MLH1) (MaxLight 405)

Sign In for Pricing
View Details
Anti-Renin receptor/ATP6AP2 Antibody Picoband®, Dylight594 Conjugate
A02665-3-Dylight594 100 µg

Anti-Renin receptor/ATP6AP2 Antibody Picoband®, Dylight594 Conjugate

Sign In for Pricing
View Details
Recombinant Human KAD5 (FLAG)
orb3068068 50 µg

Recombinant Human KAD5 (FLAG)

Sign In for Pricing
View Details
Human NTRK1 Monoclonal Antibody
orb3152767-01 50 µg

Human NTRK1 Monoclonal Antibody

Sign In for Pricing
View Details
Human NTRK1 Monoclonal Antibody
orb3152767-02 100 µg

Human NTRK1 Monoclonal Antibody

Sign In for Pricing
View Details