Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

USP12 Rabbit Polyclonal Antibody (FITC)

USP12 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

UBH1, USP12L1

UniProt

O75317

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human USP12

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ITRLRKENELFDNYMQQDAHEFLNYLLNTIADILQEERKQEKQNGRLPNG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_872294

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-human TEM1 / Endosialin / CD248 (Ontuxizumab Biosimilar)
BIO0361SM-20mg 20 mg

Anti-human TEM1 / Endosialin / CD248 (Ontuxizumab Biosimilar)

Sign In for Pricing
View Details
Camel Trifunctional Enzyme Subunit Beta, Mitochondrial (HADHB) ELISA Kit
MBS9926334-01 48 Well

Camel Trifunctional Enzyme Subunit Beta, Mitochondrial (HADHB) ELISA Kit

Sign In for Pricing
View Details
Camel Trifunctional Enzyme Subunit Beta, Mitochondrial (HADHB) ELISA Kit
MBS9926334-02 96 Well

Camel Trifunctional Enzyme Subunit Beta, Mitochondrial (HADHB) ELISA Kit

Sign In for Pricing
View Details
Camel Trifunctional Enzyme Subunit Beta, Mitochondrial (HADHB) ELISA Kit
MBS9926334-03 5x 96 Well

Camel Trifunctional Enzyme Subunit Beta, Mitochondrial (HADHB) ELISA Kit

Sign In for Pricing
View Details
Camel Trifunctional Enzyme Subunit Beta, Mitochondrial (HADHB) ELISA Kit
MBS9926334-04 10x 96 Well

Camel Trifunctional Enzyme Subunit Beta, Mitochondrial (HADHB) ELISA Kit

Sign In for Pricing
View Details
2-drawer upright freezer rack for 50 mL tubes, 60 tube capacity, 16 1/2 in L x 5 1/2 in W x 9 15/16 in H, stainless steel
2483-3850 1 Each

2-drawer upright freezer rack for 50 mL tubes, 60 tube capacity, 16 1/2 in L x 5 1/2 in W x 9 15/16 in H, stainless steel

Sign In for Pricing
View Details