Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

USP12 Rabbit Polyclonal Antibody (HRP)

USP12 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

UBH1, USP12L1

UniProt

O75317

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human USP12

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ITRLRKENELFDNYMQQDAHEFLNYLLNTIADILQEERKQEKQNGRLPNG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_872294

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human PLCD1 sgRNA gene knockout kit - Lentiviral human PLCD1 sgRNA gene knockout kit (plasmid)
GTR15378482 1 Vial

Lentiviral human PLCD1 sgRNA gene knockout kit - Lentiviral human PLCD1 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Beclin1, BH3 Domain (BECN1, GT197, Beclin-1, Coiled-coil myosin-like BCL2-interacting protein, Protein GT197) (Azide free) (HRP)
MBS6278157-01 0.2 mL

Beclin1, BH3 Domain (BECN1, GT197, Beclin-1, Coiled-coil myosin-like BCL2-interacting protein, Protein GT197) (Azide free) (HRP)

Sign In for Pricing
View Details
Beclin1, BH3 Domain (BECN1, GT197, Beclin-1, Coiled-coil myosin-like BCL2-interacting protein, Protein GT197) (Azide free) (HRP)
MBS6278157-02 5x 0.2 mL

Beclin1, BH3 Domain (BECN1, GT197, Beclin-1, Coiled-coil myosin-like BCL2-interacting protein, Protein GT197) (Azide free) (HRP)

Sign In for Pricing
View Details
EEF1A1 Conjugated Antibody
MBS9457436-01 0.1 mL (Biotin)

EEF1A1 Conjugated Antibody

Sign In for Pricing
View Details
EEF1A1 Conjugated Antibody
MBS9457436-02 0.1 mL (AF350)

EEF1A1 Conjugated Antibody

Sign In for Pricing
View Details
EEF1A1 Conjugated Antibody
MBS9457436-03 0.1 mL (AF405)

EEF1A1 Conjugated Antibody

Sign In for Pricing
View Details