Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LYPD5 Rabbit Polyclonal Antibody (HRP)

LYPD5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PRO4356

UniProt

Q6UWN5

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human LYPD5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: WTGPPAGQTQSNADALPPDYSVVRGCTTDKCNAHLMTHDALPNLSQAPDP

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_872379

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C3orf17 Polyclonal Antibody, Biotin Conjugated
bs-9824R-Biotin-TR 20 µL

C3orf17 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
Tax1bp3 3'UTR GFP Stable Cell Line
TU170185 1.0 mL

Tax1bp3 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Recombinant Mycobacterium sp. UvrABC system protein C (uvrC), partial
MBS1361962 Inquire

Recombinant Mycobacterium sp. UvrABC system protein C (uvrC), partial

Sign In for Pricing
View Details
TAF1A (TATA Box-binding Protein-associated Factor RNA Polymerase I Subunit A, RNA Polymerase I-specific TBP-associated Factor 48kD, TATA Box-binding Protein-associated Factor 1A, Transcription Factor SL1, Transcription Initiation Factor SL1/TIF-IB Subunit A) (PE)
134182-PE 100 µL

TAF1A (TATA Box-binding Protein-associated Factor RNA Polymerase I Subunit A, RNA Polymerase I-specific TBP-associated Factor 48kD, TATA Box-binding Protein-associated Factor 1A, Transcription Factor SL1, Transcription Initiation Factor SL1/TIF-IB Subunit A) (PE)

Sign In for Pricing
View Details
RAB27B Rabbit Polyclonal Antibody (Fluoro488)
orb3104760 100 µg

RAB27B Rabbit Polyclonal Antibody (Fluoro488)

Sign In for Pricing
View Details
rno??miR-196a miRNA Inhibitor
MIR01243 2x 5.0 nmol

rno??miR-196a miRNA Inhibitor

Sign In for Pricing
View Details