Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FLJ36070 Rabbit Polyclonal Antibody (Biotin)

FLJ36070 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

MASTR

UniProt

Q6ZN01

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human FLJ36070

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: QPHPRMKPSPLTPCPPGVPSPSPPPHKLELQTLKLEELTVSELRQQLRLR

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_872380

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Translationally-controlled tumor protein (TPT1) ELISA Kit
RK08691 96 Tests

Mouse Translationally-controlled tumor protein (TPT1) ELISA Kit

Sign In for Pricing
View Details
Monoclonal Antibody to Fc Fragment Of IgG Low Affinity IIIa Receptor (FcgR3A)
MBS2170136-01 0.1 mL

Monoclonal Antibody to Fc Fragment Of IgG Low Affinity IIIa Receptor (FcgR3A)

Sign In for Pricing
View Details
Monoclonal Antibody to Fc Fragment Of IgG Low Affinity IIIa Receptor (FcgR3A)
MBS2170136-02 0.2 mL

Monoclonal Antibody to Fc Fragment Of IgG Low Affinity IIIa Receptor (FcgR3A)

Sign In for Pricing
View Details
Monoclonal Antibody to Fc Fragment Of IgG Low Affinity IIIa Receptor (FcgR3A)
MBS2170136-03 0.5 mL

Monoclonal Antibody to Fc Fragment Of IgG Low Affinity IIIa Receptor (FcgR3A)

Sign In for Pricing
View Details
Monoclonal Antibody to Fc Fragment Of IgG Low Affinity IIIa Receptor (FcgR3A)
MBS2170136-04 1 mL

Monoclonal Antibody to Fc Fragment Of IgG Low Affinity IIIa Receptor (FcgR3A)

Sign In for Pricing
View Details
Monoclonal Antibody to Fc Fragment Of IgG Low Affinity IIIa Receptor (FcgR3A)
MBS2170136-05 5 mL

Monoclonal Antibody to Fc Fragment Of IgG Low Affinity IIIa Receptor (FcgR3A)

Sign In for Pricing
View Details