Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLCB1 Rabbit Polyclonal Antibody (Biotin)

PLCB1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

DEE12, PLC-I, EIEE12, PI-PLC, PLC154, PLCB1A, PLCB1B, PLC-154, PLC-beta-1

UniProt

D3DW13

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PLCB1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: EAQSKRQEKLVEKHKEIRQQILDEKPKGEGSSSFLSETCHEDPSVSPNFT

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

134kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_877398

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CRISP3 Rabbit Polyclonal Antibody
orb585931 100 µL

CRISP3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human MICA*018 Protein, C-His
MBS1579420-01 0.1 mg

Recombinant Human MICA*018 Protein, C-His

Sign In for Pricing
View Details
Recombinant Human MICA*018 Protein, C-His
MBS1579420-02 1 mg

Recombinant Human MICA*018 Protein, C-His

Sign In for Pricing
View Details
Recombinant Human MICA*018 Protein, C-His
MBS1579420-03 5x 1 mg

Recombinant Human MICA*018 Protein, C-His

Sign In for Pricing
View Details
Recombinant Toll Interleukin 1 Receptor Domain Containing Adaptor Protein (TIRAP)
MBS2030840-01 0.01 mg

Recombinant Toll Interleukin 1 Receptor Domain Containing Adaptor Protein (TIRAP)

Sign In for Pricing
View Details
Recombinant Toll Interleukin 1 Receptor Domain Containing Adaptor Protein (TIRAP)
MBS2030840-02 0.05 mg

Recombinant Toll Interleukin 1 Receptor Domain Containing Adaptor Protein (TIRAP)

Sign In for Pricing
View Details