Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAT2B Rabbit Polyclonal Antibody (FITC)

MAT2B Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

TGR, MAT-II, SDR23E1, MATIIbeta, Nbla02999

UniProt

A8K7A4

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MAT2B

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GNLAKEAAAVGAFLIYISSDYVFDGTNPPYREEDIPAPLNLYGKTKLDGE

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_877725

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CXCL12, CT (CXCL12, SDF1, SDF1A, SDF1B, Stromal cell-derived factor 1, C-X-C motif chemokine 12, Intercrine reduced in hepatomas, Pre-B cell growth-stimulating factor, SDF-1-beta(3-72), SDF-1-alpha(3-67)) (MaxLight 650)
MBS6290207-01 0.1 mL

CXCL12, CT (CXCL12, SDF1, SDF1A, SDF1B, Stromal cell-derived factor 1, C-X-C motif chemokine 12, Intercrine reduced in hepatomas, Pre-B cell growth-stimulating factor, SDF-1-beta(3-72), SDF-1-alpha(3-67)) (MaxLight 650)

Sign In for Pricing
View Details
CXCL12, CT (CXCL12, SDF1, SDF1A, SDF1B, Stromal cell-derived factor 1, C-X-C motif chemokine 12, Intercrine reduced in hepatomas, Pre-B cell growth-stimulating factor, SDF-1-beta(3-72), SDF-1-alpha(3-67)) (MaxLight 650)
MBS6290207-02 5x 0.1 mL

CXCL12, CT (CXCL12, SDF1, SDF1A, SDF1B, Stromal cell-derived factor 1, C-X-C motif chemokine 12, Intercrine reduced in hepatomas, Pre-B cell growth-stimulating factor, SDF-1-beta(3-72), SDF-1-alpha(3-67)) (MaxLight 650)

Sign In for Pricing
View Details
Rat IRGM shRNA Plasmid
abx989174-01 150 µg

Rat IRGM shRNA Plasmid

Sign In for Pricing
View Details
Rat IRGM shRNA Plasmid
abx989174-02 300 µg

Rat IRGM shRNA Plasmid

Sign In for Pricing
View Details
CD44v9 (Marker of Tumor Metastasis) (CD44v9/1459), CF568 conjugate, 0.1mg/mL
BNC681459-100 1x 100 µL

CD44v9 (Marker of Tumor Metastasis) (CD44v9/1459), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Influenza A H1N1 (A/California/04/2009) Hemagglutinin/HA-specific B cell probe (His)
TMPY-04588-01 5 µg

Influenza A H1N1 (A/California/04/2009) Hemagglutinin/HA-specific B cell probe (His)

Sign In for Pricing
View Details