Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCFD1 Rabbit Polyclonal Antibody (FITC)

SCFD1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

SLY1, RA410, SLY1P, STXBP1L2, C14orf163

UniProt

B7Z4U7

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SCFD1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SAVTQVAKVFDQYLNFITLEDDMFVLCNQNKELVSYRAINRPDITDTEME

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

65kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_878255

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-PPP4R1 Antibody Picoband®, FITC Conjugate
A14144-2-FITC 100 µg/Vial

Anti-PPP4R1 Antibody Picoband®, FITC Conjugate

Sign In for Pricing
View Details
Rat Adrenergic Receptor Beta 1 ELISA Kit
MBS059585-01 48 Well

Rat Adrenergic Receptor Beta 1 ELISA Kit

Sign In for Pricing
View Details
Rat Adrenergic Receptor Beta 1 ELISA Kit
MBS059585-02 96 Well

Rat Adrenergic Receptor Beta 1 ELISA Kit

Sign In for Pricing
View Details
Rat Adrenergic Receptor Beta 1 ELISA Kit
MBS059585-03 5x 96 Well

Rat Adrenergic Receptor Beta 1 ELISA Kit

Sign In for Pricing
View Details
Rat Adrenergic Receptor Beta 1 ELISA Kit
MBS059585-04 10x 96 Well

Rat Adrenergic Receptor Beta 1 ELISA Kit

Sign In for Pricing
View Details
TIMM8B Antibody Blocking Peptide
orb1506530 500 µg

TIMM8B Antibody Blocking Peptide

Sign In for Pricing
View Details