Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCFD1 Rabbit Polyclonal Antibody (HRP)

SCFD1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SLY1, RA410, SLY1P, STXBP1L2, C14orf163

UniProt

B7Z4U7

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SCFD1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SAVTQVAKVFDQYLNFITLEDDMFVLCNQNKELVSYRAINRPDITDTEME

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

65kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_878255

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human DIS3 Protein, N-His
HA080012-01 50 µg

Recombinant Human DIS3 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human DIS3 Protein, N-His
HA080012-02 100 µg

Recombinant Human DIS3 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human DIS3 Protein, N-His
HA080012-03 1 mg

Recombinant Human DIS3 Protein, N-His

Sign In for Pricing
View Details
Zfp469 Protein Vector (Rat) (pPM-C-HA)
PV317868 500 ng

Zfp469 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Lentiviral human FIGLA shRNA (UAS) - Lentiviral human FIGLA shRNA (UAS, iRFP) (100)
GTR15323370 1 Vial

Lentiviral human FIGLA shRNA (UAS) - Lentiviral human FIGLA shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Cell adhesion molecule 4 Rabbit Polyclonal Antibody (BF555)
orb2406792 100 µL

Cell adhesion molecule 4 Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details