Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RD3 Rabbit Polyclonal Antibody (HRP)

RD3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

LCA12, C1orf36

UniProt

Q7Z3Z2

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human RD3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GQMREAERQQRERSNAVRKVCTGVDYSWLASTPRSTYDLSPIERLQLEDV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

23kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human

Tested Applications

WB

NCBI Accession Number

NP_898882

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Alpha-1-Antitrypsin (a1AT) ELISA Kit
RDR-a1AT-Mu-48Tests 48 Tests

Mouse Alpha-1-Antitrypsin (a1AT) ELISA Kit

Sign In for Pricing
View Details
CD160 Polyclonal Antibody
orb1414397 100 µL

CD160 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Anaplastic Lymphoma Kinase Antibody / ALK
orb2635783 100 µg

Recombinant Anaplastic Lymphoma Kinase Antibody / ALK

Sign In for Pricing
View Details
Ribosome-Inactivating Protein Charybdin Polyclonal Antibody
A64234-100 100 µL

Ribosome-Inactivating Protein Charybdin Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral human BPNT2 sgRNA gene knockout kit - Lentiviral human BPNT2 sgRNA gene knockout kit (100)
GTR15381574 1 Vial

Lentiviral human BPNT2 sgRNA gene knockout kit - Lentiviral human BPNT2 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
CDK13-set siRNA/shRNA/RNAi Lentivector (Human)
15689091 4x 500 ng

CDK13-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details