Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RD3 Rabbit Polyclonal Antibody (HRP)

RD3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

LCA12, C1orf36

UniProt

Q7Z3Z2

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human RD3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GQMREAERQQRERSNAVRKVCTGVDYSWLASTPRSTYDLSPIERLQLEDV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

23kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human

Tested Applications

WB

NCBI Accession Number

NP_898882

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

MMP19 (Matrix Metalloproteinase 19, MMP18, RASI-1) (MaxLight 550)
MBS6447720-01 0.1 mL

MMP19 (Matrix Metalloproteinase 19, MMP18, RASI-1) (MaxLight 550)

Sign In for Pricing
View Details
MMP19 (Matrix Metalloproteinase 19, MMP18, RASI-1) (MaxLight 550)
MBS6447720-02 5x 0.1 mL

MMP19 (Matrix Metalloproteinase 19, MMP18, RASI-1) (MaxLight 550)

Sign In for Pricing
View Details
Psen1 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4595702 1.0 µg DNA

Psen1 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Sheep CKLF-like MARVEL transmembrane domain-containing protein 5 (CMTM5) ELISA Kit
MBS7202979-01 48 Well

Sheep CKLF-like MARVEL transmembrane domain-containing protein 5 (CMTM5) ELISA Kit

Sign In for Pricing
View Details
Sheep CKLF-like MARVEL transmembrane domain-containing protein 5 (CMTM5) ELISA Kit
MBS7202979-02 96 Well

Sheep CKLF-like MARVEL transmembrane domain-containing protein 5 (CMTM5) ELISA Kit

Sign In for Pricing
View Details
Sheep CKLF-like MARVEL transmembrane domain-containing protein 5 (CMTM5) ELISA Kit
MBS7202979-03 5x 96 Well

Sheep CKLF-like MARVEL transmembrane domain-containing protein 5 (CMTM5) ELISA Kit

Sign In for Pricing
View Details